LYSMD3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2087421
Artikelname: LYSMD3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2087421
Hersteller Artikelnummer: orb2087421
Alternativnummer: BYT-ORB2087421-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LYSMD3
Konjugation: FITC
LYSMD3 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 938014
UniProt: Q7Z3D4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSPAAQQET