ARHGAP33 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2087427
Artikelname: ARHGAP33 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2087427
Hersteller Artikelnummer: orb2087427
Alternativnummer: BYT-ORB2087427-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ARHGAP33
Konjugation: FITC
Alternative Synonym: SNX26, TCGAP, NOMA-GAP
ARHGAP33 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 92kDa
NCBI: 001166101
UniProt: O14559
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPVPRLPQKQRAPW