L3HYPDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087449
Artikelname: L3HYPDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087449
Hersteller Artikelnummer: orb2087449
Alternativnummer: BYT-ORB2087449-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human L3HYPDH
Konjugation: Biotin
Alternative Synonym: C14orf149
L3HYPDH Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 653182
UniProt: Q96EM0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLE