DGLUCY Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2087738
Artikelname: DGLUCY Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2087738
Hersteller Artikelnummer: orb2087738
Alternativnummer: BYT-ORB2087738-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf159
Konjugation: HRP
Alternative Synonym: C14orf159
DGLUCY Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
UniProt: Q7Z3D6
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIA