DGLUCY Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2087739
Artikelname: DGLUCY Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2087739
Hersteller Artikelnummer: orb2087739
Alternativnummer: BYT-ORB2087739-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf159
Konjugation: FITC
Alternative Synonym: C14orf159
DGLUCY Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
UniProt: Q7Z3D6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIA