SLC35E1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2087751
Artikelname: SLC35E1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2087751
Hersteller Artikelnummer: orb2087751
Alternativnummer: BYT-ORB2087751-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35E1
Konjugation: FITC
SLC35E1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 079157
UniProt: Q96K37
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGL