TCTN2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2087759
Artikelname: TCTN2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2087759
Hersteller Artikelnummer: orb2087759
Alternativnummer: BYT-ORB2087759-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TCTN2
Konjugation: HRP
Alternative Synonym: MKS8, TECT2, JBTS24, C12orf38
TCTN2 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 001137322
UniProt: Q96GX1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VIPGAVLEVTVRWKRGLDWCSSNETDSFSESPCILQTLLVSASHNSSCSA