CAMKMT Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2087768
Artikelname: CAMKMT Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2087768
Hersteller Artikelnummer: orb2087768
Alternativnummer: BYT-ORB2087768-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAMKMT
Konjugation: HRP
Alternative Synonym: Cam, KMT, CLNMT, C2orf34, CaM KMT
CAMKMT Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 079042
UniProt: Q7Z624
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLIL