NDNF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2087810
Artikelname: NDNF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2087810
Hersteller Artikelnummer: orb2087810
Alternativnummer: BYT-ORB2087810-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDNF
Konjugation: HRP
Alternative Synonym: HH25, NORD, C4orf31
NDNF Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 078850
UniProt: Q8TB73
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY