TRAPPC6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087839
Artikelname: TRAPPC6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087839
Hersteller Artikelnummer: orb2087839
Alternativnummer: BYT-ORB2087839-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAPPC6A
Konjugation: Biotin
Alternative Synonym: TRS33
TRAPPC6A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 077013
UniProt: O75865
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET