C1orf50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087842
Artikelname: C1orf50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087842
Hersteller Artikelnummer: orb2087842
Alternativnummer: BYT-ORB2087842-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human C1orf50
Konjugation: Biotin
Alternative Synonym: C1orf50,
C1orf50 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 077002
UniProt: Q9BV19
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCP