C11orf75 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087929
Artikelname: C11orf75 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087929
Hersteller Artikelnummer: orb2087929
Alternativnummer: BYT-ORB2087929-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C11orf75
Konjugation: Biotin
Alternative Synonym: FN5, C11orf75
C11orf75 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 6kDa
NCBI: 064564
UniProt: Q9NRQ5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPT