TEX13B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087938
Artikelname: TEX13B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087938
Hersteller Artikelnummer: orb2087938
Alternativnummer: BYT-ORB2087938-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TEX13B
Konjugation: Biotin
Alternative Synonym: TGC3B, TSGA5
TEX13B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 112563
UniProt: Q9BXU2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETSLAEVQRE