Tma16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2088004
Artikelname: Tma16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2088004
Hersteller Artikelnummer: orb2088004
Alternativnummer: BYT-ORB2088004-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Tma16
Konjugation: Biotin
Alternative Synonym: 1810029B16Rik
Tma16 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 079741
UniProt: Q9CR02
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IGDKLQWFHSHLDMKKTRYSKKDACELVERYLDRFSSELEQIELQNSIKD