FIBIN Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2088308
Artikelname: FIBIN Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2088308
Hersteller Artikelnummer: orb2088308
Alternativnummer: BYT-ORB2088308-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FIBIN
Konjugation: HRP
FIBIN Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 976249
UniProt: Q8TAL6
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKET