FIBIN Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2088309
Artikelname: FIBIN Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2088309
Hersteller Artikelnummer: orb2088309
Alternativnummer: BYT-ORB2088309-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FIBIN
Konjugation: FITC
FIBIN Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 976249
UniProt: Q8TAL6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKET