C3orf26 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2088665
Artikelname: C3orf26 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2088665
Hersteller Artikelnummer: orb2088665
Alternativnummer: BYT-ORB2088665-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C3orf26
Konjugation: HRP
Alternative Synonym: C3orf26
C3orf26 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 001161396
UniProt: B4DUM1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTR