BTBD18 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2088690
Artikelname: BTBD18 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2088690
Hersteller Artikelnummer: orb2088690
Alternativnummer: BYT-ORB2088690-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD18
Konjugation: FITC
BTBD18 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 78kDa
NCBI: 001138573
UniProt: B2RXH4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IEGEEWCLPDMELWPRELTELEKEPAGENRGPTELLSPLVMPSEVSEVLS