BTBD18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2088691
Artikelname: BTBD18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2088691
Hersteller Artikelnummer: orb2088691
Alternativnummer: BYT-ORB2088691-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD18
Konjugation: Biotin
BTBD18 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 78kDa
NCBI: 001138573
UniProt: B2RXH4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IEGEEWCLPDMELWPRELTELEKEPAGENRGPTELLSPLVMPSEVSEVLS