BOLA3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2088706
Artikelname: BOLA3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2088706
Hersteller Artikelnummer: orb2088706
Alternativnummer: BYT-ORB2088706-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BOLA3
Konjugation: Biotin
Alternative Synonym: MMDS2
BOLA3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 997717
UniProt: Q53S33
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKR