ATAD3C Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2088716
Artikelname: ATAD3C Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2088716
Hersteller Artikelnummer: orb2088716
Alternativnummer: BYT-ORB2088716-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATAD3C
Konjugation: HRP
ATAD3C Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 001034300
UniProt: Q5T2N8
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QMQEQTLQLEQQSKLKQLVNEDLRKQEESVQKHHQTFLESIRAAGTLFGE