PLEKHG3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2088934
Artikelname: PLEKHG3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2088934
Hersteller Artikelnummer: orb2088934
Alternativnummer: BYT-ORB2088934-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLEKHG3
Konjugation: Biotin
Alternative Synonym: ARHGEF43, KIAA0599
PLEKHG3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 128kDa
NCBI: 056364
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PGGRPSARSPLSPTETFSWPDVRELCSKYASRDEARRAGGGRPRGPPVNR