PDZD11 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2088950
Artikelname: PDZD11 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2088950
Hersteller Artikelnummer: orb2088950
Alternativnummer: BYT-ORB2088950-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDZD11
Konjugation: HRP
Alternative Synonym: PISP, AIPP1, PDZK11
PDZD11 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 057568
UniProt: Q5EBL8
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTV