PDZD11 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2088951
Artikelname: PDZD11 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2088951
Hersteller Artikelnummer: orb2088951
Alternativnummer: BYT-ORB2088951-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDZD11
Konjugation: FITC
Alternative Synonym: PISP, AIPP1, PDZK11
PDZD11 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 057568
UniProt: Q5EBL8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTV