OSGEPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2088964
Artikelname: OSGEPL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2088964
Hersteller Artikelnummer: orb2088964
Alternativnummer: BYT-ORB2088964-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OSGEPL1
Konjugation: Biotin
Alternative Synonym: Qri7, OSGEPL
OSGEPL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 071748
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQL