OR52A5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2088973
Artikelname: OR52A5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2088973
Hersteller Artikelnummer: orb2088973
Alternativnummer: BYT-ORB2088973-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR52A5
Konjugation: Biotin
Alternative Synonym: OR11-33
OR52A5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 001005160
UniProt: Q9H2C5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IRVNKIYGLFVAFAILGFDIIFITLSYVQIFITVFQLPQKEARFKAFNTC