NSUN5P1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089001
Artikelname: NSUN5P1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089001
Hersteller Artikelnummer: orb2089001
Alternativnummer: BYT-ORB2089001-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NSUN5P2
Konjugation: HRP
Alternative Synonym: NSUN5B, WBSCR20B
NSUN5P1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
UniProt: Q3KNT7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAK