NSUN5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089004
Artikelname: NSUN5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089004
Hersteller Artikelnummer: orb2089004
Alternativnummer: BYT-ORB2089004-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NSUN5
Konjugation: HRP
Alternative Synonym: NOL1, p120, NOL1R, NSUN5A, WBSCR20, WBSCR20A, p120(NOL1)
NSUN5 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 683759
UniProt: Q96P11
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA