NEMF Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089011
Artikelname: NEMF Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089011
Hersteller Artikelnummer: orb2089011
Alternativnummer: BYT-ORB2089011-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEMF
Konjugation: FITC
Alternative Synonym: IDDSAPN, NY-CO-1, SDCCAG1
NEMF Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 118kDa
NCBI: 004704
UniProt: O60524
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP