FAM49B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089225
Artikelname: FAM49B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089225
Hersteller Artikelnummer: orb2089225
Alternativnummer: BYT-ORB2089225-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM49B
Konjugation: Biotin
Alternative Synonym: L1, CYRI, BM-009, CYRI-B, FAM49B
FAM49B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 057707
UniProt: Q9NUQ9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPA