CABP7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089333
Artikelname: CABP7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089333
Hersteller Artikelnummer: orb2089333
Alternativnummer: BYT-ORB2089333-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CABP7
Konjugation: Biotin
Alternative Synonym: CALN2
CABP7 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 872333
UniProt: Q86V35
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVR