Arpp19 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer:
BYT-ORB2089362
| Artikelname: |
Arpp19 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2089362 |
| Hersteller Artikelnummer: |
orb2089362 |
| Alternativnummer: |
BYT-ORB2089362-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-Arpp19 antibody is: synthetic peptide directed towards the N-terminal of Mouse ARP19 |
| Konjugation: |
FITC |
| Alternative Synonym: |
19kDa, Arpp12, ARPP-19, AW559096, 2700024H10Rik |
| Arpp19 Rabbit Polyclonal Antibody (FITC) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
10 kDa |
| UniProt: |
P56212 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYN |
