Arpp19 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089362
Artikelname: Arpp19 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089362
Hersteller Artikelnummer: orb2089362
Alternativnummer: BYT-ORB2089362-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-Arpp19 antibody is: synthetic peptide directed towards the N-terminal of Mouse ARP19
Konjugation: FITC
Alternative Synonym: 19kDa, Arpp12, ARPP-19, AW559096, 2700024H10Rik
Arpp19 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 10 kDa
UniProt: P56212
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYN