SOWAHC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089383
Artikelname: SOWAHC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089383
Hersteller Artikelnummer: orb2089383
Alternativnummer: BYT-ORB2089383-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SOWAHC
Konjugation: FITC
Alternative Synonym: ANKRD57, C2orf26
SOWAHC Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 075392
UniProt: Q53LP3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TYKLSHALEDGGDHHHHHHSAEGWVGGKAKDPGRKASGSSSGRIKPRLNK