ACTR6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089405
Artikelname: ACTR6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089405
Hersteller Artikelnummer: orb2089405
Alternativnummer: BYT-ORB2089405-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACTR6
Konjugation: Biotin
Alternative Synonym: ARP6, CDA12, hARP6, hARPX, HSPC281, MSTP136
ACTR6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 071941
UniProt: Q9GZN1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEM