Snx30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089453
Artikelname: Snx30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089453
Hersteller Artikelnummer: orb2089453
Alternativnummer: BYT-ORB2089453-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Snx30
Konjugation: Biotin
Alternative Synonym: 4732481H14Rik, C030041J06Rik
Snx30 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 766056
UniProt: Q8CE50
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VSACIGNCSTALEELTDDITEEFLPVLREYVLYSDSMKGVLKKRDQVQAE