SLFN5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089456
Artikelname: SLFN5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089456
Hersteller Artikelnummer: orb2089456
Alternativnummer: BYT-ORB2089456-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLFN5
Konjugation: Biotin
SLFN5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 98kDa
NCBI: 659412
UniProt: Q08AF3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VDAGKVTLGTQQRQEMDPRLREKQNEIILRAVCALLNSGGGIIKAEIENK