RINL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089516
Artikelname: RINL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089516
Hersteller Artikelnummer: orb2089516
Alternativnummer: BYT-ORB2089516-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RINL
Konjugation: Biotin
Alternative Synonym: FLJ44131, FLJ45909
RINL Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 940847
UniProt: Q6ZS11
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG