PSMB11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089534
Artikelname: PSMB11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089534
Hersteller Artikelnummer: orb2089534
Alternativnummer: BYT-ORB2089534-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PSMB11
Konjugation: Biotin
Alternative Synonym: BETA5T
PSMB11 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 001093250
UniProt: A5LHX3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAED