NADSYN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089593
Artikelname: NADSYN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089593
Hersteller Artikelnummer: orb2089593
Alternativnummer: BYT-ORB2089593-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NADSYN1
Konjugation: FITC
Alternative Synonym: VCRL3
NADSYN1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 78kDa
NCBI: 060631
UniProt: Q6IA69
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG