MYSM1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089604
Artikelname: MYSM1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089604
Hersteller Artikelnummer: orb2089604
Alternativnummer: BYT-ORB2089604-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYSM1
Konjugation: HRP
Alternative Synonym: 2ADUB, BMFS4, 2A-DUB
MYSM1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 001078956
UniProt: Q5VVJ2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC