MYSM1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089605
Artikelname: MYSM1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089605
Hersteller Artikelnummer: orb2089605
Alternativnummer: BYT-ORB2089605-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYSM1
Konjugation: FITC
Alternative Synonym: 2ADUB, BMFS4, 2A-DUB
MYSM1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 001078956
UniProt: Q5VVJ2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC