MSGN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089611
Artikelname: MSGN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089611
Hersteller Artikelnummer: orb2089611
Alternativnummer: BYT-ORB2089611-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MSGN1
Konjugation: FITC
Alternative Synonym: MSOG, pMsgn1
MSGN1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 001099039
UniProt: A6NI15
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPP