MORN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089623
Artikelname: MORN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089623
Hersteller Artikelnummer: orb2089623
Alternativnummer: BYT-ORB2089623-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MORN1
Konjugation: FITC
MORN1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 079124
UniProt: Q5T089
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AQEPPGGSRPEGRATEEQAAAAHLGEYVLMIRDVTTPPFLGRRLPPAFKH