LY6G5C Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089632
Artikelname: LY6G5C Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089632
Hersteller Artikelnummer: orb2089632
Alternativnummer: BYT-ORB2089632-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LY6G5C
Konjugation: FITC
Alternative Synonym: G5C, NG33, C6orf20, LY6G5CA, LY6G5CB
LY6G5C Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
UniProt: Q5SRR4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDF