ISOC1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089655
Artikelname: ISOC1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089655
Hersteller Artikelnummer: orb2089655
Alternativnummer: BYT-ORB2089655-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISOC1
Konjugation: HRP
Alternative Synonym: CGI-111
ISOC1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 057132
UniProt: Q96CN7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNL