ISOC1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2089656
Artikelname: ISOC1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2089656
Hersteller Artikelnummer: orb2089656
Alternativnummer: BYT-ORB2089656-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISOC1
Konjugation: FITC
Alternative Synonym: CGI-111
ISOC1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 057132
UniProt: Q96CN7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNL