GPR135 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089681
Artikelname: GPR135 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089681
Hersteller Artikelnummer: orb2089681
Alternativnummer: BYT-ORB2089681-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-GPR135 antibody is: synthetic peptide directed towards the C-terminal region of Human GP135
Konjugation: Biotin
Alternative Synonym: HUMNPIIY20
GPR135 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54 kDa
NCBI: 072093
UniProt: Q8IZ08
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SVVAVWLTWANGAINPVIYAIRNPNISMLLGRNREEGYRTRNVDAFLPSQ