FCGR2C Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089706
Artikelname: FCGR2C Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089706
Hersteller Artikelnummer: orb2089706
Alternativnummer: BYT-ORB2089706-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FCGR2C
Konjugation: HRP
Alternative Synonym: CD32, FCG2, CD32C, CDW32, IGFR2, FCRIIC
FCGR2C Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 963857
UniProt: P31995
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD