EPS8L3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2089709
Artikelname: EPS8L3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2089709
Hersteller Artikelnummer: orb2089709
Alternativnummer: BYT-ORB2089709-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EPS8L3
Konjugation: HRP
Alternative Synonym: HYPT5, EPS8R3
EPS8L3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
UniProt: Q8TE67
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLGR