XKR6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2089795
Artikelname: XKR6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2089795
Hersteller Artikelnummer: orb2089795
Alternativnummer: BYT-ORB2089795-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human XKR6
Konjugation: Biotin
Alternative Synonym: XRG6, C8orf5, C8orf7, C8orf21
XKR6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
UniProt: Q5GH73
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LASYHKLLRDSRDDKKSMSYRGAIIQVFWRLFTISSRVISFALFASIFQL